<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    W6WL, L10V, I13IV, G16E, E35D, M36I, R41K, R57K, L63C, H69K, K70KR, L89M  
>3764| codons 6-99
LQRPVVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQICIE
ICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6ED, K11KT, V35T, T39E, K122E, D123S, I159IV, S162CY, S163SC, T165TI, K173T, Q174K, D177E, I178IM, Q207A, R211S, K238R  
>3764| codons 1-244
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAVFQYCMIKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPI

References
Author Title Citation
Duc, NB Surveillance of transmitted HIV drug resistance using matched plasma and dried blood spot specimens from voluntary counseling and testing sites in Ho Chi Minh City, Vietnam, 2007-2008 Clin Infect Dis, 2012