<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P50 P50-96 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 EFV 2
3 EFV+IDV 96

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10I, I13V, K20I, M36I, D60E, Q61E, I62M, L63P, I64M, A71V, I72T, I93L  
>P50-96| C07 | codons 1-99 | clone C07
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
EVPMEICGHKVTGTVLVGPTPVNIIGRNLMTQLGCTLNF
>P50-96| C06 | codons 1-99 | clone C06
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYE
EMPMEICGHKVTGTVLVGPTPVNIIGRNLMTQLGCTLNF
>P50-96| C11 | codons 1-99 | clone C11
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYE
EMPMEICGHKVTGTVLVGPTPVNIIGRNLMTQLGCALNF
>P50-96| C04 | codons 1-99 | clone C04
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
EMPMEICGHKVTGTVLVGPTPVNIIGRNLMTQLGCTLNF
>P50-96| C10 | codons 1-99 | clone C10
PQITLWQRPIVTVKIGGQLIEAPLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYE
EMPMEICGHKVTGTVLVGPTPVNIIGRNLMTQLGCTLNF
>P50-96| C08 | codons 1-99 | clone C08
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYE
EMPMEICGHKVTGTVLVGPTPVNIIGRNLMTQLGCTLNF
>P50-96| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYE
EMPMEICGHKVTGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   K103N   V35T, R83K, R211K  
>P50-96| C07 | codons 1-229 | clone C07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLKWGFYTPDKKHQKEPPFLW
>P50-96| C10 | codons 1-229 | clone C10
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSGMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLW
>P50-96| C04 | codons 1-229 | clone C04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLW
>P50-96| C06 | codons 1-229 | clone C06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKTGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEAQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSISNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLW
>P50-96| C08 | codons 1-229 | clone C08
PISPIETVSVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLW
>P50-96| C11 | codons 1-229 | clone C11
LISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIGELRQHLLKWGFYTPDKKHQKEPPFLW
>P50-96| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005