<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P50 P50-24 U.S. 1996 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 EFV 2
3 EFV+IDV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L76V   L10I, I13V, M36I, D60E, Q61E, I62V, L63P, I64M, A71V, I72T, I93L  
>P50-24| A05 | codons 1-99 | clone A05
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
EVPMEICGHKVTGTVVVGPTPVNIIGRNLLTQLGCTLNF
>P50-24| A06 | codons 1-99 | clone A06
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
EVPMEICGHKVTGTVVVGPTPVNIIERNLLTQLGCTLNF
>P50-24| A02 | codons 1-99 | clone A02
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLGEINLPGRWKPKMIGGIGGFIKVRQYE
EVPMETCGHKVTGTVVVGPTPVNIIGRNLLTQLGCTLNF
>P50-24| A08 | codons 1-99 | clone A08
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFNKVRQYE
EVPMEICGHKVTGTVVVGPTPVNIIGRNLLTQLGCTLNF
>P50-24| A03 | codons 1-99 | clone A03
PQITLWQRPIVTVKIGGQLKEALIDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
EVPMEICGHKVTGTVVVGPTPVNIIGRNLLTQLGCTLNF
>P50-24| A04 | codons 1-99 | clone A04
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
EVPMEICGHKVTGTVVVGPTPVNIIGRNLLTQLGCTLNF
>P50-24| A01 | codons 1-99 | clone A01
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
EVPMEICGHKVTGTVVVGPTPVNIIGRNLLTQLGCTLNF
>P50-24| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
EVPMEICGHKVTGTVVVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35I, R83K, R211K  
>P50-24| A08 | codons 1-229 | clone A08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P50-24| A04 | codons 1-229 | clone A04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENSYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAILQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEHPFLW
>P50-24| A01 | codons 1-229 | clone A01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKSVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P50-24| A07 | codons 2-229 | clone A07
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPVF
AIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIGQHRTKIEELRQHLLKWEFTTPDKKHQKEPPFLW
>P50-24| A05 | codons 1-229 | clone A05
PISPIETVPVKLRPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDTVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLSKWGFTTPDKKHQKEPPFLW
>P50-24| A06 | codons 1-229 | clone A06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAMKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P50-24| A03 | codons 1-229 | clone A03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P50-24| A02 | codons 1-229 | clone A02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P50-24| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005