<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KEN-11T KEN-11T Kenya 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, R41K, L63P, I64L, V77I  
>KEN-11T| codons 4-99
TLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIP
LEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, K32G, A33C, L34T, V35L, E36N, I37F, V60I, K122E, I159V, D177E, Q207E, R211K, V245K P157PS
>KEN-11T| codons 30-247
QIGCTLNFCTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSSAVFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELREHL
LKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Yang, C Global surveillance of transmitted HIV-1 drug resistance in PEPFAR-supported countries using a broadly sensitive genotyping assay CROI 2011, 2011