<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KEN-32T KEN-32T Kenya 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    V11F, I13V, G16E, M36I, R41K, L63H, K70KR, I72V R8P
>KEN-32T| codons 7-99
QPPLFTVKIEGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIHIEI
CGHRAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, K32G, A33C, L34T, V35L, E36N, I37F, V60I, K122E, I135V, D177E, T200A, E204K, Q207E, V245K  
>KEN-32T| codons 30-247
QIGCTLNFCTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEKLREHL
LRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Yang, C Global surveillance of transmitted HIV-1 drug resistance in PEPFAR-supported countries using a broadly sensitive genotyping assay CROI 2011, 2011