<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KEN-80T KEN-80T Kenya 2007 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, E35D, M36I, N37D, R41K, R57K, L63T, H69K, L89M  
>KEN-80T| codons 5-99
LWQRPVVTIKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYDQITI
EICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E36K, I37F, T39M, V60I, K122KE, D123S, I135T, S162A, K173A, Q174K, D177E, V179I, Q207D, R211K, V245EK  
>KEN-80T| codons 36-247
KFCMEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQASMTKILEPFRAKNPEIIIYQYMDDLYVGSDLEIGQHRTKIEELRDHLLKWGFT
TPDKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Yang, C Global surveillance of transmitted HIV-1 drug resistance in PEPFAR-supported countries using a broadly sensitive genotyping assay CROI 2011, 2011