<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KN-45 KN-45 Kenya 2007 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11Q, V35T, V60I, V118I, D121H, K122E, I135R, K173S, Q174K, D177E, V179I, T200A, Q207A, R211S, F214L, V245E, D250E  
>KN-45| codons 1-254
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, K14R, L19LI, K20R, E35D, M36I, N37DE, R41K, K45R, R57K, C67Y, H69K, L89M  
>KN-45| codons 9-99
PLVSVRIGGQIREALLDTGADDTVLEDIELPGKWKPRMIGGIGGFIKVKQYDQILIEIYG
KKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Yang, C Global surveillance of transmitted HIV-1 drug resistance in PEPFAR-supported countries using a broadly sensitive genotyping assay CROI 2011, 2011