<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KN-39 KN-39 Kenya 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, L33V, P39T, R41K, D60E, I62V, L63P, H69Y  
>KN-39| codons 8-99
RPLVSVKIGGQLKEALLDTGADDTVVEEMNLTGKWKPKMIGGIGGFIKVRQYEQVPIEIC
GYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V8I, V35T, T39M, K49R, V60I, K122E, D123NS, S162N, D177E, I202V, Q207G, R211K, V245Q  
>KN-39| codons 1-256
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKVEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVND

References
Author Title Citation
Yang, C Global surveillance of transmitted HIV-1 drug resistance in PEPFAR-supported countries using a broadly sensitive genotyping assay CROI 2011, 2011