<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KN-98 KN-98 Kenya 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, N37K, R41N, K45R, D60E, L63P, H69K, I72M, L89I, I93L G40E
>KN-98| codons 9-99
PLVSIKVGGQIKEALLDTGADDTVLEEIKLPENWKPRMIGGIGGFIKVRQYEQIPIEICG
KKAMGTVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V8I, V35I, T39K, E42K, S48T, A158S, K173T, D177E, T200A, Q207E, R211K, F214L, V245Q R72K
>KN-98| codons 1-257
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALIEICKEMKKEGKITKIGPENPYNTPV
FAIKKKDSTKWKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDI

References
Author Title Citation
Yang, C Global surveillance of transmitted HIV-1 drug resistance in PEPFAR-supported countries using a broadly sensitive genotyping assay CROI 2011, 2011