<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, N37K, R41N, K45R, D60E, L63P, H69K, I72M, L89I, I93L G40E
>KN-98| codons 9-99
PLVSIKVGGQIKEALLDTGADDTVLEEIKLPENWKPRMIGGIGGFIKVRQYEQIPIEICG
KKAMGTVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V8I, V35I, T39K, E42K, S48T, A158S, K173T, D177E, T200A, Q207E, R211K, F214L, V245Q R72K
>KN-98| codons 1-257
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALIEICKEMKKEGKITKIGPENPYNTPV
FAIKKKDSTKWKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDI

References
Author Title Citation
Yang, C HIV-1 Sequences from Kenya, Direct Submission. Direct Genbank Submission, 2012