<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KN-96 KN-96 Kenya 2007 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, E35D, M36I, R41K, R57K, L63V, H69K, L89M  
>KN-96| codons 5-99
LWQRPLVSVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIVI
EICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V21I, V35T, T39A, E40D, V60I, K122E, D123N, I135T, K173S, Q174KR, D177E, V179I, T200A, I202V, Q207A, R211S  
>KN-96| codons 1-241
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSRNPEIII
YQYMDDLYVGSDLEIGQHRAKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
V

References
Author Title Citation
Yang, C Global surveillance of transmitted HIV-1 drug resistance in PEPFAR-supported countries using a broadly sensitive genotyping assay CROI 2011, 2011