<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19IV, M36MI, N37NS, R41K, I62V, L63V, I64L, H69K, A71T, L89M, I93L  
>B0564| codons 13-99
IKVGGQVKEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYDQVVLEICGKKTI
GTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48E, V60I, K122E, D123S, K173T, Q174K, D177E, T200A, Q207E, V245E, E248D  
>B0564| codons 1-251
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKIEKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKDS

References
Author Title Citation
Bussmann, H Prevalence of transmitted HIV drug resistance in Botswana: Lessons learned from the HIVDR-threshold survey conducted among women presenting for routine antenatal care as part of the 2007 national sentinel survey. ARHR, 2011