<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P39 P39-60 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82T   L10I, N37D, L63P, V77I, I93L  
>P39-60| C08 | codons 1-99 | clone C08
PQNTLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPTNIIGRNLLTQLGCTLNF
>P39-60| C03 | codons 1-99 | clone C03
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGTGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPTNIIGRNLLTQLGCTLNF
>P39-60| C05 | codons 1-99 | clone C05
PQITLW*RPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGVGGFIKVRQYD
QVHIEICGHKAIGTVLIGPTPTNIIGRNLLTQLGCTLNF
>P39-60| C01 | codons 1-99 | clone C01
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFNKVRQYD
QIPIEICGHKAIGTVLIGPTPTNIIGRNLLTQLGCTLNF
>P39-60| C02 | codons 1-99 | clone C02
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPTNIIGRNLLTQLGCTLNF
>P39-60| C06 | codons 1-99 | clone C06
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRLYD
QVHIEICGHKAIGTVLIGPTPTNIIGRNLLTQLGCTLNF
>P39-60| C04 | codons 1-99 | clone C04
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QVHIEICGHKAIGTVLIGPTPTNIIGRNLLTQLGCTLNF
>P39-60| C09 | codons 1-99 | clone C09
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPTNIIGRNLLTQLGCTLNF
>P39-60| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPTNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   G190S   T27S, I142V, Q207N, R211K  
>P39-60| C06 | codons 1-229 | clone C06
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
YQYMDDLYVSSDLEIGQHRTKIEELRNHLLKWGFYTPDKKHQKEPPFLW
>P39-60| C09 | codons 1-229 | clone C09
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVSSDLEIGQHRTKIEELRNHLLKWGFYTPDKKHQKEPPFLW
>P39-60| C05 | codons 1-229 | clone C05
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDIVI
YQYMDDLYVSSDLEIGQHRTKIEELRNHLLKWGFYTPDKKHQKEPPFLW
>P39-60| C02 | codons 1-229 | clone C02
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVSSDLEIGQHGTKIEELRNHLLKWGFYTPDKKHQKEPPFLW
>P39-60| C08 | codons 1-229 | clone C08
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTELEKEGKISKIGPENPYNTPA
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFREYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDIVI
YQYMDDLYVSSDLEIGQHRTKIEELRNHLLEWGFYTPDKKHQKEPPFLW
>P39-60| C04 | codons 1-229 | clone C04
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYISSDLEIGQHRTKIEELRNHLLKWGFYTPDKKHQKEPPFLW
>P39-60| C01 | codons 1-229 | clone C01
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVSSDLEIGQHRTKIEELRNHLLKWGFYTPDKKHQKEPPFLW
>P39-60| C03 | codons 1-229 | clone C03
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGGAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGPPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVSSDLEIGQHRTKIEELRNHLLKWGFYTPDKKHQKEPPFLW
>P39-60| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVSSDLEIGQHRTKIEELRNHLLKWGFYTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005