<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P37 P37-60 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I L24I E35D, M36I, I62V, L63P, H69Q, V77I  
>P37-60| 111E05 | codons 1-99 | clone 111E05
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-60| E01 | codons 1-99 | clone E01
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPRIIGGIGGFIKVRQYD
QVPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-60| E02 | codons 1-99 | clone E02
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-60| E08 | codons 1-99 | clone E08
PQIALWQRPLATIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-60| E07 | codons 1-99 | clone E07
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFTKVRQYD
QVPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-60| E04 | codons 1-99 | clone E04
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-60| E06 | codons 1-99 | clone E06
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-60| codons 1-99
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   A98S, I135V, T200A  
>P37-60| E04 | codons 1-229 | clone E04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKRHQKEPPFLW
>P37-60| 111E05 | codons 1-229 | clone 111E05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P37-60| E02 | codons 1-229 | clone E02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNAPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P37-60| E01 | codons 1-229 | clone E01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P37-60| E07 | codons 1-229 | clone E07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAHFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P37-60| E06 | codons 1-229 | clone E06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P37-60| E08 | codons 1-229 | clone E08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DRDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P37-60| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005