<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I L10I, T12Q, I13V, K14KR, I15V, L19P, K20I, E35D, M36I, R41K, L63T, H69K, L89M  
>2010693474| codons 6-99
WQRPIIQVRVGGQPIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQITIE
ICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179DE P4T, E6K, K11S, V35T, T39N, V60I, K102Q, K122E, D123S, A158S, K173A, D177EG, T200A, Q207D, R211K, V245Q, E248D  
>2010693474| codons 1-248
PISTIKTVPVSLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAQNPGIEI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPD

References
Author Title Citation
Yang, C Sequences from Angola, Direct submission. Direct Genbank Submission, 2010