<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15IV, G16E, E35D, M36I, R41K, R57K, L63T, E65D, L89M  
>2010693458| codons 7-99
QRPVVTVKVEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQITIDI
CGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, D123E, I135V, S162C, K173A, Q174K, T200A, Q207N, R211K, V245Q, E248D  
>2010693458| codons 1-251
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDS

References
Author Title Citation
Serrano, D Low transmitted drug resistance and high viral genetic diversity of HIV-1 strains circulating in young pregnant women recently diagnosed with HIV-1 infection in Luada, Angola ASLM 2012, 2012