<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I L10I, T12K, I13V, L19V, M36I, N37D, R41K, I62V, L63A, H69Q, V82I, L89M  
>2010693452| codons 6-99
WQRPIIKVKIGGQVKEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYDQVAIE
ICGQKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39R, V90I, D121H, K122E, K166R, K173A, Q174K, D177E, V179I, T200E, Q207A, R211N, Q242QR, V245Q, E248N, D250E T58A
>2010693452| codons 1-251
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICREMEKEGKISKIGPENPYNAPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAKNPEIII
YQYMDDLYVGSDLEIGQHREKIEELRAHLLNWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VRPIQLPNKES

References
Author Title Citation
Yang, C Sequences from Angola, Direct submission. Direct Genbank Submission, 2010