<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P26 P26-23 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 EFV 2
3 EFV+IDV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A L24I I15V, E35D, N37D, L63P, A71V  
>P26-23| G07 | codons 1-99 | clone G07
PQITLWQRPLVTIKVGGQLKEALIDTGADDTVLEDMDLPGRWKPKLIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P26-23| G01 | codons 1-99 | clone G01
PQITLWQ*PIVTIKVGGQLKEALIDTGADDTVLEDMDLPGRWKPKLIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P26-23| G05 | codons 1-99 | clone G05
PQITLWQRPLVTIKVGGQLKEALIDTGADDTVLEDMDLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLT*IGCTLNF
>P26-23| G03 | codons 1-99 | clone G03
PQITLWQRPLVTIKVGGQLKEALIDTGADDTVLEDMDLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P26-23| G08 | codons 1-99 | clone G08
PQITLWQRPIVTIKVGGQLKEALLDTGADDTILEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P26-23| G06 | codons 1-99 | clone G06
PQITLWQRPLVTIKVGGQLKEALLDTGADDTILEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P26-23| G09 | codons 1-99 | clone G09
PQITLWQRPLVTIKVGGQLKEALLDTGADDTILEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGQKIIGTVLVGPTPANIIGRNLLTQVGCTLNF
>P26-23| codons 1-99
PQITLWQRPLVTIKVGGQLKEALIDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R   K103N, Y188L   D121Y, K122E, E138A, S162C, T200A  
>P26-23| G01 | codons 1-229 | clone G01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFREVQLGIPHPAGLKNNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTMPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P26-23| G06 | codons 1-229 | clone G06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P26-23| G03 | codons 1-229 | clone G03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNDTPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKDPPFLW
>P26-23| G07 | codons 1-229 | clone G07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNDTPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P26-23| G05 | codons 1-229 | clone G05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P26-23| G09 | codons 1-229 | clone G09
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKDPPFLW
>P26-23| G08 | codons 1-229 | clone G08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNDTPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKNIRKNLHSFG
>P26-23| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005