<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P25 P25-0 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L33V, R41K, L63Q, I64V, E65D  
>P25-0| B07c | codons 1-99 | clone B07c
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P25-0| B05c | codons 1-99 | clone B05c
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P25-0| B04a | codons 1-99 | clone B04a
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P25-0| A06g | codons 1-99 | clone A06g
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P25-0| B04b | codons 1-99 | clone B04b
PQIALWQRPLVTVKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P25-0| B03c | codons 1-99 | clone B03c
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P25-0| B01a | codons 1-99 | clone B01a
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLVGLTPVNIIGRNLLTQIGCTLNF
>P25-0| B06b | codons 1-99 | clone B06b
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P25-0| B01 | codons 1-99 | clone B01
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P25-0| B08b | codons 1-99 | clone B08b
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P25-0| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  A62V, V75I     K20R, R83K, K103R, G196E, T200A, R211K  
>P25-0| B05c | codons 1-229 | clone B05c
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPL
FVIKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P25-0| B04a | codons 1-229 | clone B04a
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSIKWRKLIDFRELNKKTQDSWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DRDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRAKIEDLRQHLLKWGFTTPDKKHQKEPPFLW
>P25-0| B08b | codons 1-229 | clone B08b
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLIDFRELNKKTQDLWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRAKIEDLRQHLLRWGFTTPDKKHQKEPPFLW
>P25-0| B07c | codons 1-229 | clone B07c
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P25-0| B03b | codons 1-229 | clone B03b
PISPIETVPVKLKPGVDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYHVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P25-0| B01 | codons 1-229 | clone B01
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P25-0| B06b | codons 1-229 | clone B06b
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIENLRQHLLKWGFTTPDKKHQKEPPFLW
>P25-0| A06g | codons 1-229 | clone A06g
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVSSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P25-0| B04b | codons 1-229 | clone B04b
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKVSKIGPENPYNTPV
FVIKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDVVI
YQYMDDLYVESDLEIEQHRAKIEDLRQHLLKWGFTTPDKKHQKEPPFLW
>P25-0| B03c | codons 1-229 | clone B03c
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVESDLEIEQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P25-0| B01a | codons 1-229 | clone B01a
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVLKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVESDLEIEQHRTKIEELRQRLLRWGFTTPDKKHQKEPPFLW
>P25-0| codons 1-229
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005