<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I62V, L63P, A71V, I72V, V77I, I93L  
>06001138| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQVP
IEICGHKVVGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184MV, L210W, T215Y K219N L100I, K103N   T39A, K43N, S68G, K122E, E138A, I142T, S163I, E169D, V179I, T200A, R211K  
>06001138| codons 38-247
CAELENEGKISKIGPENPYNTPVFAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNATPGTRYQYNVLPQGWKGSP
AIFQSIMTKILDPFRKQNPDIIIYQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Truong, HH Sentinel surveillance of HIV-1 transmitted drug resistance, acute infection and recent infection. PLoS ONE, 2011