<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-011-040 079-011-040 Thailand 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 252

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V V75M V106A F227L V35T, T39E, D121H, K122E, K173A, Q174K, D177E, I178L, T200A, E203K, Q207D, R211S, V245T  
>079-011-040| codons 20-259
KVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPVFAIKKKDSTRWRKLMDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPLHEDFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPELVIYQYVDDLYVGSDLEIGQHR
AKIKELRDHLLSWGFTTPDKKHQKEPPLLWMGYELHPDKWTVQPITLPEKDSWTVNDIQK

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011