<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-010-045 079-010-045 Thailand 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 363
2 3TC+AZT+NVP 85

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   G190A   V35T, T39K, K43E, S68G, D123N, K173L, Q174K, I178M, V179I, Q207A, R211S, K238R, V245E  
>079-010-045| codons 20-263
KVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKNFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPDMIIYQYVDDLYVASDLEIGQHR
TKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPIELPEKDSWTVNDIQK
LVGK

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011