<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-011-034 079-011-034 Thailand 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 9
2 3TC+D4T+EFV 56

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y188L   V35T, T39K, K43Q, K122E, D123S, K166R, K173I, Q174K, D177E, Q207A, R211S, V245E, K249R  
>079-011-034| codons 20-262
KVKQWPLTEEKIKALTEICKEMEQEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKNPEIVIYQYVDDLLVGSDLEIGQHR
TKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPERDSWTVNDIQK
LVG

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011