<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-008-013 079-008-013 Thailand 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 82

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q K101E, G190A   E28K, T39A, R83K, D123E, K166R, D177E, T200A, R211K, F214L  
>079-008-013| codons 20-239
KVKQWPLTKEKIKALVEICAEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRE
LNKKTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVIYQYVDDLYVASDLEIGQHR
AKIEELRQHLLKWGLFTPDQKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011