<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-011-032 079-011-032 Thailand 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 197
2 None NA
3 3TC+AZT+NVP 88

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   Y188L   V90I, K102R, V106I, K122E, I135V, S162C, G196E, Q207E, F214L, E224D, K238R  
>079-011-032| codons 20-244
KVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTRWRKLVDFRE
LNKRTQDFWEIQLGIPHPAGLKRKKSITVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNET
PGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYVDDLLVGSDLEIEQHR
TKIEELREHLLRWGLTTPDKKHQKDPPFLWMGYELHPDRWTVQPI

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011