<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-001-015 079-001-015 Thailand 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 65
2 3TC+AZT+NVP 113

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   V35T, T39R, K122E, D123S, I135T, E138Q, I159V, Q174E, D177E, V179I, G196E, I202V, Q207A, V245E, E248N  
>079-001-015| codons 20-259
KVKQWPLTEEKIKALTEICREMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNQT
PGIRYQYNVLPQGWKGSPAVFQSSMTKILEPFRKENPEIIICQYMDDLYVGSDLEIEQHR
TKVEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPNKDSWTVNDIQK

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011