<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-010-039 079-010-039 Thailand 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 1
2 None NA
3 3TC+D4T+EFV 84

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q G190A A98G K20R, V35T, T39K, K43E, K101Q, K122E, D123S, E138Q, K173I, Q174K, D177E, I178M, V179I, T200I, I202V, Q207A, R211S, V245K  
>079-010-039| codons 20-263
RVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRE
LNKRTQDFWEVQLGIPHPGGLQKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNQT
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMIIYQYVDDLYVASDLEIGQHR
IKVEELRAHLLSWGFFTPDQKHQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWTVNDIQK
LVGK

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011