<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 37
2 None NA
3 3TC+D4T+EFV 12
4 None NA
5 3TC+D4T+EFV 114

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184I   K103N   K20R, I31L, V35T, T39K, K43E, V90I, A98S, K122E, D123S, T165I, K173T, Q174K, D177E, T200A, I202V, Q207A, R211S, H221Y, V245E L264Q
>079-008-005| codons 20-265
RVKQWPLTEEKLKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEIQLGIPHPSGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRTKNPEIVIYQYIDDLYVGSDLEIGQHR
AKVEELRAHLLSWGFTTPDKKYQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVNDIQK
LVGKQN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, E35D, M36I, R41K, H69K, L89M  
>079-008-005Pr| codons 1-99
PQITLWQRPVVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011