<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 278
2 3TC+AZT+NVP 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215F   Y181C, G190A V108I V35T, T39K, K43E, K49R, S117A, K122E, D123S, I167V, K173I, Q174K, D177E, G196E, Q207A, R211S, H221Y, K238R, V245E E44L
>079-005-015| codons 20-255
KVKQWPLTEEKIKALTEICKELEELGKISRIGPENPYNTPVFAIKKKNSTKWRKLMDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFAVPLDESFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRIKNPEIVICQYVDDLYVASDLEIEQHR
TKIEELRAHLWSWGFFTPDKKYQKEPPFLWMGYELHPDRWTVQPIELPEKDSWTVN

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011