<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-011-020 079-011-020 Thailand 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 154

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F V75I Y181C   K20R, I31L, V35I, T39R, K43E, K122E, D123S, I135L, S162Y, K173T, Q174K, D177E, Q207A, R211S, V245E  
>079-011-020| codons 20-254
RVKQWPLTEEKLKALIEICREMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLIDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSLNNET
PGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKNPEIVICQYVDDLYVGSDLEIGQHR
TKIEELRAHLLSWGFFTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTV

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011