<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P11 P11-21 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 EFV+IDV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, N37D, L63S, I64V, Q92K  
>P11-21| codons 1-99
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-21| C04 | codons 1-99 | clone C04
PQITLWQRPLVTVKIEG*LKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-21| C03 | codons 1-99 | clone C03
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-21| C08 | codons 1-99 | clone C08
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVSEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-21| C06 | codons 1-99 | clone C06
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-21| C09 | codons 1-99 | clone C09
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-21| C05 | codons 1-99 | clone C05
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-21| C10 | codons 1-99 | clone C10
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIVCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   R83K, E169D, G196E, T200A  
>P11-21| C08 | codons 1-229 | clone C08
PFSPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-21| C10 | codons 1-229 | clone C10
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGEAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-21| C05 | codons 1-229 | clone C05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTISSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPGIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-21| C04 | codons 1-229 | clone C04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-21| C06 | codons 1-229 | clone C06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-21| C03 | codons 1-229 | clone C03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPRPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-21| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-21| C09 | codons 1-229 | clone C09
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGMPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005