<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-007-007 079-007-007 Thailand 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 43
2 3TC+AZT+NVP 34
3 3TC+NVP+TDF 40

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V   Y181C V108I V35T, T39K, K43E, D123N, T165A, K173T, Q174K, D177E, V179I, T200K, I202V, Q207A, R211S, V245K  
>079-007-007| codons 20-262
KVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPLDKNFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMAKILEPFRTKNPEIIICQYVDDLYVGSDLEIGQHR
KKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWTVNDIQK
LVG

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011