<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P11 P11-9 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 EFV+IDV 9

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, N37D, L63S, I64V, Q92K  
>P11-9| codons 1-99
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-9| F04 | codons 1-99 | clone F04
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-9| F01 | codons 1-99 | clone F01
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R   K103N   E42D, T69N, R83K, E169D, E194K, G196E, T200A D113G
>P11-9| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMDKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGGAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLKIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-9| F04 | codons 1-229 | clone F04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-9| F01 | codons 1-229 | clone F01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMDKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGGAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLKIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005