<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-004-012 079-004-012 Thailand 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 233

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69~, Q151M, M184I K219R Y181C V108I V35T, E36K, T39E, S68~, V90I, A98S, K122E, D123N, I132L, I142V, K173A, Q174K, D177E, I178M, T200I, I202V, Q207A, R211S, F214L, V245E K65Q
>079-004-012| codons 20-263
KVKQWPLTEEKIKALTKICEEMEKEGKISKIGPENPYNTPVFAIKQKD~~KWRKLVDFRE
LNKRTQDFWEIQLGIPHPSGLKKKKSVTILDVGDAYFSVPLDENFRKYTAFTLPSINNET
PGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRAKNPEMVICQYIDDLYVGSDLEIGQHR
IKVEELRAHLLSWGLTTPDRKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVNDIQK
LVGK

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011