<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P11 P11-16 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 EFV+IDV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, N37D, L63S, I64V, Q92K  
>P11-16| codons 1-99
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-16| H05 | codons 1-99 | clone H05
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPTMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-16| H06 | codons 1-99 | clone H06
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-16| H07 | codons 1-99 | clone H07
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-16| H03 | codons 1-99 | clone H03
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF
>P11-16| H11 | codons 1-99 | clone H11
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R   K103N   T69N, R83K, E169D, G196E, T200A  
>P11-16| H11 | codons 1-229 | clone H11
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEEEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKETQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-16| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-16| H03 | codons 1-229 | clone H03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSTTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-16| H02 | codons 3-229 | clone H02
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFA
IKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAILQSSMTKILDPFRKQNPDIVIYQ
YMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-16| H06 | codons 1-229 | clone H06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVPVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-16| H07 | codons 1-229 | clone H07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKTSKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P11-16| H05 | codons 1-229 | clone H05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005