<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-003-008 079-003-008 Thailand 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 231

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184I F116Y Y181C, G190A   V35M, T39A, S68G, V90I, T107S, D121H, K122E, F214L  
>079-003-008| codons 20-263
KVKQWPLTEEKIKALMEICAEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRE
LNKRTQDFWEIQLGIPHPAGLKKKKSVSVLDVGDAYYSVPLHEDFRKYTAFTIPSINNET
PGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYIDDLYVASDLEIGQHR
TKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQK
LVGK

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011