<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-004-005 079-004-005 Thailand 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 424

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, L210W, T215Y   K103N K238T K32N, V60I, S68G, A98S, K122P, I135L, E138A, I178L, V179L, Q207E, R211K, V245E  
>079-004-005| codons 20-255
KVKQWPLTEEKINALVEICTEMEKEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSLNNAT
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLLIYQYVDDLYVGSDLEIGQHR
TKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDTWTVQPIELPEKDSWTVN

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011