<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-005-003 079-005-003 Thailand 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 264

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F   Y181C, G190A   V35T, T39K, K43E, K101Q, K122E, D123N, K173T, Q174K, D177E, I178V, T200A, Q207A, R211S, V245E, K249R  
>079-005-003| codons 20-258
KVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEVVICQYVDDLYVASDLEIGQHR
AKIEELRAHLLSWGFFTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPERDSWTVNDIQ

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011