<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-010-018 079-010-018 Thailand 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 88

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C V179D S68G, I135V, I142V, I178L, Q197K, H221Y, V245L  
>079-010-018| codons 20-265
KVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNET
PGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLDICQYVDDLYVGSDLEIGKHR
TKIEELRQHLLRWGFTTPDKKYQKEPPFLWMGYELHPDKWTVQPILLPEKDSWTVNDIQK
LVGKLN

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011