<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|D4T|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   Y181C V179D V35T, T39K, K43E, T69N, K103R, K122E, D123S, I135V, K173I, Q174K, D177E, T200I, Q207A, R211S, V245Q  
>079-010-002| codons 20-264
KVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSNRWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSVNNET
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIDICQYVDDLYVGSDLEIGQHR
IKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKDSWTVNDIQK
LVGKL

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011