<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-001-003 079-001-003 Thailand 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC|D4T|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   Y181C   L34I, V35T, T39K, K43E, K122E, D123S, I135R, S162C, K173M, Q174K, V179I, I202V, Q207A, R211S, H221Y, K238R  
>079-001-003| codons 20-244
KVKQWPLTEEKIKAITEICKELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSRNNET
PGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRMKNPDIIICQYVDDLYVGSDLEIGQHR
TKVEELRAHLLSWGFYTPDKKYQKEPPFLWMGYELHPDRWTVQPI

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011