<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
079-003-003 079-003-003 Thailand 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 73

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   Y181C V108I V35T, T39E, K122E, D123S, I135T, T139R, K173T, Q174K, D177E, I178M, V189I, Q207A, R211K, V245K  
>079-003-003| codons 20-262
KVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPLDESFRKYTAFTIPSTNNER
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVICQYVDDLYIGSDLEIGQHR
TKIEELRAHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWTVNDIQK
LVG

References
Author Title Citation
Bunupuradah, T Etravirine and rilpivirine resistance in HIV-1 subtype CRF01_AE-infected adults failing non-nucleoside reverse transcriptase inhibitor-based regimens. Antivir Ther, 2011