<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10M, T12S, I15V, L19I, M36I, N37A, R41K, R57K, L63H, H69K, L89M, I93L  
>1005371| codons 1-99
PQITLWQRPMVSIKVGGQIKEALLDTGADDTVLEEIALPGKWKPKMIGGIGGFIKVKQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K122E, D123S, I135T, S162Y, K173A, D177E, T200I, Q207E, V245Q, A272P, L279M, T286A, E291D, V292I, I293V  
>1005371| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRIKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQMCKLLRGAKALTDIVPLTEEAE

References
Author Title Citation
Manasa, J Primary drug resistance in South Africa - data from 20 years of surveys. ARHR, 2011