<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB5-P167 P167-41 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 16
2 3TC+AZT+EFV+PI 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R57K, L63P, V77I, I93L  
>P167-41| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P167-41| D09 | codons 1-99 | clone D09
PQITLWQRPLVTIKMGGQLKEALLDTGADDTVLEDINLPGRWKPKIIGGIGGLIKVKQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGFTLNF
>P167-41| D10 | codons 1-99 | clone D10
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P167-41| D07 | codons 1-99 | clone D07
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N   K103N   V21I, I135M, S162C, Q207E, R211A  
>P167-41| D07 | codons 1-229 | clone D07
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLAWGFTTPDKKHQKEPPFLW
>P167-41| D09 | codons 1-229 | clone D09
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLAWGFTTPDKKHQKEPPFLW
>P167-41| D10 | codons 1-229 | clone D10
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKTSKIGPEDPYNTPV
FAIKKRNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLAWGLTTPDKKHQKEPPFLW
>P167-41| codons 1-229
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLAWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005