<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V31I, M50V, F100Y, L101I, T112V, T124A, T125A, K136Q, V201I, T206S, T218I, L234I, A265V, R269K, D278A S283G
>SK200| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAVHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGADCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19V, E35D, M36I, R41K, H69K, L89M, I93L  
>SK200| codons 1-99
PQITLWQRPLVSIKVGGQVKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T351E, K353Q, A355*, R356V, G359A, T377L, K390R, A400T, E404D, V435A, E449D, K465R, D471E, H483Q, S519N, Q520N, K530R, A534S, A554S  
>SK200| codons 350-560
KEGQY*VMRAAHTNDVKQLTEAVQKIALESIVIWGKTPKFRLPIQKETWETWWTDYWQAT
WIPEWEFVNTPPLVKLWYQLEKEPIAGAETFYVDGAANRDTKLGKAGYVTDRGRQRVVSL
TETTNQKTELQAIQLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNNIIEQLIKKE
RVYLSWVPAHKGIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Matthews, PC Central role of reverting mutations in HLA associations with human immunodeficiency virus set point. J Virol, 2008