<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB5-P165 P165-0 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I N37E, I62V, L63P, A71T  
>P165-0| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMELPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P165-0| E10 | codons 1-99 | clone E10
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMELPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P165-0| E07 | codons 1-99 | clone E07
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMELPGRWKPKMIGGIGGFIKVRQYD
QVLIEICGHKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P165-0| E12 | codons 1-99 | clone E12
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMELPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P165-0| E02 | codons 1-99 | clone E02
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMELPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTVGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P165-0| E03 | codons 1-99 | clone E03
PQITLWQRPLVTIKIGGQLREALLDTGADDTVIEEMELPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V118I, T165I, Q207E, F214L  
>P165-0| E12 | codons 1-229 | clone E12
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGLTTPDKKHQKEPPFLW
>P165-0| E10 | codons 1-229 | clone E10
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKEKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDACFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKTEELREHLLRWGLTTPDKKHQKEPPFLW
>P165-0| E02 | codons 1-229 | clone E02
PIGPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGLENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGLTTPDKKHQKEPPFLW
>P165-0| E03 | codons 1-229 | clone E03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGLTTPDKKHQKEPPFLW
>P165-0| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGLTTPDKKHQKEPPFLW
>P165-0| E07 | codons 1-229 | clone E07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGLTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005