<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  T97A K14R, V31I, L101I, T112V, T124A, T125A, K136Q, V180A, V201I, T218I, L234I, R269K, D278A S283G
>SK133| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQEAAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAA
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIKDYGKQMAGADCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, P44X, L63P, H69K, I93L  
>SK133| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKXKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11N, V35T, E36A, T39E, S48T, E53D, K64R, V90I, K122E, D123N, A158S, S162A, T200A, Q207E, R211K, F214L, Q242R, V245L, A272P, K277R, T286A, E291D, V292I, I293V, Q334H, G335D, R356K, G359T, T377L, K390R, A400M, E404D, V435A, A437V, L452I, V466I, V467E, D471E, T477A, H483L, L491S, V493A, S519N, K527N, K530R, V531I, A534S, A554K  
>SK133| codons 1-560
PISPIETVPVNLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPDNPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VRPILLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIALESIVIWGKTPKFRLPIQKETWEMWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGVETFYVDGAANRETKIGKAGYVTDRGRQKIESLTETTNQKAELQ
AILLALQDSGSEANIVTDSQYALGIIQAQPDKSESELVNQIIEQLINKERIYLSWVPAHK
GIGGNEQVDKLVSKGIRKVL

References
Author Title Citation
Matthews, PC Central role of reverting mutations in HLA associations with human immunodeficiency virus set point. J Virol, 2008