<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P153 P153-66 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 12
3 3TC+AZT+EFV+IDV 54

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y188L   E6D, V60I, S68G, T69N, D123E, I135T, Q207A, L210S  
>P153-66| codons 1-229
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIEELRAHLSRWGFTTPDKKHQKEPPFLW
>P153-66| H01 | codons 1-229 | clone H01
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIEELRAHLSRWGFTTPDKKHQKEPPFLW
>P153-66| H11 | codons 1-229 | clone H11
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLLVGSDLEIGQHRTKIEELRAHLLRWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82T   T12P, K14R, I15V, R41K, D60E, Q61E, I62V, L63P, C67S, I72V, I93L  
>P153-66| codons 1-99
PQITLWQRPLVPIRVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYE
EVPIEISGHKAVGTVLVGPTPTNIIGRNLLTQLGCTLNF
>P153-66| H01 | codons 1-99 | clone H01
PQITLWQRPLVPIRVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYE
EVPIEISGHKAVGTVLVGPTPTNIIGRNLLTQLGCTLNF
>P153-66| H11 | codons 1-99 | clone H11
PQITLWQRPLVPIRVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYE
EVPIEISGHKAVGTVLVGPTPTNIIGRNLLTQLGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005