<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P149 P149-0 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       T39K, V60I, V90I, T139M, I142V, A158S  
>P149-0| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICKELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEMPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P149-0| G06 | codons 1-229 | clone G06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEMPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P149-0| G04 | codons 1-229 | clone G04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICKELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEMPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P149-0| G03 | codons 1-229 | clone G03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICKELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEMPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFREQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P149-0| G07 | codons 1-229 | clone G07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICKELEKEGKISKIGPENPYNTPI
FAIKKKDSTK*RKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFREYTAFTIPSINNEMPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFGKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P149-0| G05 | codons 1-229 | clone G05
PIGPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICKELEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEMPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPLLW
>P149-0| G01 | codons 1-229 | clone G01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVETCKELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEMPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P149-0| G08 | codons 1-229 | clone G08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICKELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEMPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P149-0| G02 | codons 1-229 | clone G02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICKELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEMPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L33V, L89M  
>P149-0| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
>P149-0| G06 | codons 1-99 | clone G06
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
>P149-0| G08 | codons 1-99 | clone G08
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEVCGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
>P149-0| G02 | codons 1-99 | clone G02
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAVGTVLVGPTPVSIIGRNMLTQIGCTLNF
>P149-0| G04 | codons 1-99 | clone G04
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
>P149-0| G03 | codons 1-99 | clone G03
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
>P149-0| G07 | codons 1-99 | clone G07
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPERWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNITGRNMLTQIGCTLNF
>P149-0| G05 | codons 1-99 | clone G05
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
>P149-0| G01 | codons 1-99 | clone G01
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005