<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V8I, V35T, E36A, T39E, S48T, V60I, K122E, D123G, K173A, Q174K, D177G, V179I, T200A, I202V, Q207A, V245Q, D250E, S251N, A272S, T286A, E291D, V292I, I293V, G333E, Q334C, T338S, R356K, G359T, T377L, K390R, A400R, E404D, E413D, V435A, L469I, D471E, H483Q  
>SK038| codons 1-484
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPGIII
YQYMDDLYVGSDLEIGQHRAKVEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKENWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQECGQWSYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIALESIVIWGKTPKFRLPIQKETWERWWTDYWQATWIPDWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSITETTNQKTELQ
AIQL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50V   T12S, I15V, L19V, K20R, E35D, M36I, N37D, R41K, K45R, D60E, H69K, L89M, I93L  
>SK038| codons 1-99
PQITLWQRPLVSIKVGGQVREALLDTGADDTVLEDIDLPGKWKPRMIGGVGGFIKVRQYE
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Matthews, PC Central role of reverting mutations in HLA associations with human immunodeficiency virus set point. J Virol, 2008