<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P146 P146-16 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, V75M, M184V, L210W, T215Y K219R K103N V108I V35I, K43Q, E44D, V118I, D123E, I135T, K166R, I178M, E203K, Q207A, R211K, K223E, L228R  
>P146-16| D01 | codons 1-229 | clone D01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKDSDEWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIKELRAHLWKWGFYTPDRKHQEEPPLRW
>P146-16| G05 | codons 1-229 | clone G05
PISPIETVPVKLRPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSDKWRKLMDFRELNKRTQDFWEVRLGIPHPGGLKKNKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSINDETPGIRYQYNVLPQGWKGSPTIFQSSMTRILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIKELRAHLWKWGFYTPDRKHQEEPPFRW
>P146-16| D02 | codons 1-229 | clone D02
PSSPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNEAPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLKWGFYTPDKKHQKEPPFLW
>P146-16| D03 | codons 1-229 | clone D03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKDSDKWRKLMDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIKELRAHLWKWGFYTPDRKHQEEPPFRW
>P146-16| G01 | codons 1-229 | clone G01
PISPIETVPVKLKPGMDGPKVKQWPLAEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKDSDKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIKELRAHLWKWGFYTPDRKHQEEPPLRW
>P146-16| G08 | codons 1-229 | clone G08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELENDGKISKIGPENPYNTPV
FAIKKKDSDKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIKELRAHLWKWGFYTPDRKHQEEPPFRW
>P146-16| G06 | codons 1-229 | clone G06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKDSDKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTRTLEPFRKQNPDMVI
YQYVDDL*VGSDLEIGQHRTKIKELRAHLWKWGFYTPDRKHQEEPPFRW
>P146-16| G02 | codons 1-229 | clone G02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSDKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIKELRAHLWKWGFYTPDRKHQEEPPLRW
>P146-16| G07 | codons 1-229 | clone G07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIKKKDSDKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSTNNGTPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIKELRAHLWKWGFYTPDRKHQEEPPFRW
>P146-16| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKDSDKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIKELRAHLWKWGFYTPDRKHQEEPPFRW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P  
>P146-16| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P146-16| G06 | codons 1-99 | clone G06
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P146-16| G07 | codons 1-99 | clone G07
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P146-16| D01 | codons 1-99 | clone D01
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P146-16| D02 | codons 1-99 | clone D02
PQITLWQRPLVTIKIRGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P146-16| D03 | codons 1-99 | clone D03
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P146-16| G02 | codons 1-99 | clone G02
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P146-16| G01 | codons 1-99 | clone G01
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLGEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P146-16| G08 | codons 1-99 | clone G08
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P146-16| G05 | codons 1-99 | clone G05
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIEVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQNGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005